PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42188.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 482aa    MW: 52602.9 Da    PI: 6.9199
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42188.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.3e-39102161261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  KHN42188.1 102 PDKILQCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRKNKHL 161
                 7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2990159IPR003851Zinc finger, Dof-type
PfamPF027013.8E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.425106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSQTEKDPGI RLFGRKIPVP ECQIPANSGP KDACSSIMKT ELGIPSECGE NTEQQENSSD  60
SRDSKQESQH KLQENEPIVN PKPAEDDMET GSSDQDKVLK KPDKILQCPR CNSLDTKFCY  120
FNNYNVNQPR HFCKNCQRYW TAGGTMRNVP IGAGRRKNKH LASQYRHIIV TSDGIPTSRL  180
ETTDSSGLQQ QHIASLESSV PFRSSADNGT VLKFGPDIPL CESMDSMLNL RDQRRCVDAS  240
SISCVEYRGE PSLYGSSVTT NGAQGSELSE HSPSNWLQCY PVPPWVLPYP GWNNVNSMEA  300
VHRSSAPMCN PYNNTGPAAM QWCPTPMVAI PGMCPPSIPL QFVPPSYWSG TQLWNAGTGT  360
VSIGSNACLS PSSSTSNSCC SGNGSPTLGK HTRDTVCTNE EKSEKCVSVP KTIRIDAPNE  420
ASKSPIRATL AIKPDMQQFV SNGDILKKNE PKEGKDRMLG ASQILEANPA AISRAHAFQE  480
GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939660.0BT093966.1 Soybean clone JCVI-FLGm-18A13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304603.10.0cyclic dof factor 3-like
TrEMBLA0A0B2SBR20.0A0A0B2SBR2_GLYSO; Dof zinc finger protein DOF5.2
STRINGGLYMA19G29610.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-64cycling DOF factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]